SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR1733 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR1733
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000109
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR1733
Sequence length 285
Comment $ NESG $ SQ32199 $ PDBT120063 $
Sequence
MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQVFLVEIEEKELGWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHN
RVPREGRPEAEAAAPSRPPTLLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNV
LPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVR
LVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKDFCKYE
Download sequence
Identical sequences Q9BR09
ENSP00000361596 ENSP00000361596 GO.57102 HR1733 gi|18152787|ref|NP_542787.1| NP_542787.1.87134 NP_542787.1.92137 9606.ENSP00000361596 ENSP00000361596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]