SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR315 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HR315
Domain Number - Region: 5-62
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family Leucine-rich repeat variant 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR315
Sequence length 103
Comment $ NESG $ SQ30796 $ PDBT118642 $
Sequence
MLVEAIMLVTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGM
ENLLEVQVPEDVEQQLQQLDCREQEQLERELAPEPWVERATPT
Download sequence
Identical sequences Q9P0T5
HR315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]