SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3381A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3381A
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-40
Family Gelsolin-like 0.00000671
Further Details:      
 
Domain Number 2 Region: 241-433
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 3 Region: 385-521
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.08e-35
Family Gelsolin-like 0.0000631
Further Details:      
 
Domain Number 4 Region: 587-721
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.04e-33
Family Gelsolin-like 0.0000345
Further Details:      
 
Domain Number 5 Region: 507-608
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.28e-24
Family Gelsolin-like 0.00038
Further Details:      
 
Domain Number 6 Region: 120-230
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 8.11e-23
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR3381A
Sequence length 783
Comment $ NESG $ SQ101984 $ PDBT137399 $
Sequence
MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVA
SGMKHVETNTYDVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESN
SGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPELMKVLQDTLGRRSIIKPTVPDE
IIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGA
TKAEKQAAMSKALGFIKMKSYPSSTNVETVNDGAESAMFKQLFQKWSVKDQTMGLGKTFS
IGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWYGFFYG
GDCYLVLYTYEVNGKPHHILYIWQDRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGT
EPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSN
DVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQEPAEFWDLLGGKTP
YANDKRLQQEILDVQSRLFECSNKTGQFVVTEITDFTQDDLNPTDVMLLDTWDQVFLWIG
AEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFEPPIFTGWFLAWDPNIWSAGK
TYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQELPEDVNPAK
KEN
Download sequence
Identical sequences HR3381A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]