SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3381B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3381B
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-41
Family Gelsolin-like 0.00000671
Further Details:      
 
Domain Number 2 Region: 120-230
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.42e-24
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR3381B
Sequence length 243
Comment $ NESG $ SQ183298 $ PDBT143231 $
Sequence
MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVA
SGMKHVETNTYDVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESN
SGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPELMKVLQDTLGRRSIIKPTVPDE
IID
Download sequence
Identical sequences HR3381B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]