SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3557J from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3557J
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.94e-19
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR3557J
Sequence length 95
Comment $ NESG $ SQ217571 $ PDBT166372 $
Sequence
NRRKVNIMLLNGQRLELTCDTKTICKDVFDMVVAHIGLVEHHLFALATLKDNEYFFVDPD
LKLTKVAPEGWKEEPKKKTKATVNFTLFFRIKFFM
Download sequence
Identical sequences HR3557J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]