SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR4599A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4599A
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR4599A
Sequence length 69
Comment $ NESG $ SQ103321 $ PDBT136085 $
Sequence
TANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNG
EAEAFKAEI
Download sequence
Identical sequences HR4599A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]