SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HT88A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HT88A
Domain Number 1 Region: 25-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000148
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HT88A
Sequence length 100
Comment $ NESG $ SQ194822 $ PDBT158944 $
Sequence
FPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIG
RCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSP
Download sequence
Identical sequences HT88A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]