SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for IGBMC-0041-000 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IGBMC-0041-000
Domain Number 1 Region: 8-74
Classification Level Classification E-value
Superfamily Histone-fold 3.73e-16
Family TBP-associated factors, TAFs 0.015
Further Details:      
 
Domain Number 2 Region: 223-384
Classification Level Classification E-value
Superfamily ARM repeat 0.000000576
Family Armadillo repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) IGBMC-0041-000
Sequence length 516
Comment $ SPINE $ SQ80907 $ PDBT330362 $
Sequence
MSTQQQSYTIWSPQDTVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSK
RDVLTTDDVSKALRVLNVEPLYGYYDGSEVNKAVSFSKVNTSGGQSVYYLDEEEVDFDRL
INEPLPQVPRLPTFTTHWLAVEGVQPAIIQNPNLNDIRVSQPPFIRGAIVTALNDNSLQT
PVTSTTASASVTDTGASQHLSNVKPGQNTEVKPLVKHVLSKELQIYFNKVISTLTAKSQA
DEAAQHMKQAALTSLRTDSGLHQLVPYFIQFIAEQITQNLSDLQLLTTILEMIYSLLSNT
SIFLDPYIHSLMPSILTLLLAKKLGGSPKDDSPQEIHEFLERTNALRDFAASLLDYVLKK
FPQAYKSLKPRVTRTLLKTFLDINRVFGTYYGCLKGVSVLEGESIRFFLGNLNNWARLVF
NESGITLDNIEEHLNDDSNPTRTKFTKEETQILVDTVISALLVLKKDLPDLYEGKGEKVT
DEDKEKLLERCGVTIGFHILKRDDAKELISAIFFGE
Download sequence
Identical sequences A0A250WBZ2 E7Q3S6 N1P9P2 P53040
IGBMC-0041-000 YGL112C YGL112C NP_011403.1.97178 4932.YGL112C YGL112C YGL112C YGL112C YGL112C YGL112C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]