SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MPIB-429 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MPIB-429
Domain Number 1 Region: 513-706
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-57
Family Hemopexin-like domain 0.00000000298
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.45e-33
Family Matrix metalloproteases, catalytic domain 0.000000345
Further Details:      
 
Domain Number 3 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 2.8e-21
Family Fibronectin type II module 0.0000846
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-21
Family Fibronectin type II module 0.0000563
Further Details:      
 
Domain Number 5 Region: 219-273
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000665
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 4.24e-18
Family MMP N-terminal domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MPIB-429
Sequence length 707
Comment $ SPINE $ SQ80707 $ PDBT330518 $
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences MPIB-428 MPIB-429 MPIB-430 MPIB-431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]