SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MlR390 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MlR390
Domain Number 1 Region: 54-176
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-20
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MlR390
Sequence length 185
Comment $ NESG $ SQ225724 $ PDBT167634 $
Sequence
MLEIPEDRCERHRLFKAIDDAFKAGDFDGLGKALGGSPGWFDERMPFELGLGHPLEYAIY
WSPVGFISTLLDAGSDPNYQDHGGFPAIIAALSTDRADRLEVVRVLIEAGADPNMRGVND
WTPLHYSVGIRSAEAIHLLLAAGADPTLATRIDDYTTAFEEADKAGFEAGASLLRDAIAR
RGFNR
Download sequence
Identical sequences Q98NE0
266835.mll0182 gi|13470466|ref|NP_102035.1| WP_010909191.1.45716 MlR390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]