SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MypaA.01073.a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MypaA.01073.a
Domain Number 1 Region: 77-232
Classification Level Classification E-value
Superfamily Nqo5-like 4.32e-48
Family Nqo5-like 0.00016
Further Details:      
 
Weak hits

Sequence:  MypaA.01073.a
Domain Number - Region: 28-97
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0874
Family FAD/NAD-linked reductases, N-terminal and central domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MypaA.01073.a
Sequence length 235
Comment $ SSGCID $ SQ230725 $ PDBT345401 $
Sequence
MSSPDQDPREAIAQGDDEVIDVRRGMFGAAGTGDTSGYGRLVRTVTLPGSSPRPYGSYFD
DVVDTLTESLQSNGIEFHQAIEKVVVYRDELTLHVDRAALPHVAQHLRDDPRLRFEMCLG
VSGVHYPHETGRELHAVYPLQSITHNRRVRLEVAVPDEDPHIPSLYRIYPTTDWHERETY
DFFGIVFDGHPSLTRIEMPDDWHGHPQRKDYPLGGIPVEYKGAQIPPPDERRAYN
Download sequence
Identical sequences A0A200GV43 Q73V13 V7KY36
gi|41409301|ref|NP_962137.1| 262316.MAP3203 gi|499074979|ref|YP_007970457.1| MypaA.01073.a WP_003874820.1.10000 WP_003874820.1.101064 WP_003874820.1.1614 WP_003874820.1.1994 WP_003874820.1.22949 WP_003874820.1.26008 WP_003874820.1.27804 WP_003874820.1.29527 WP_003874820.1.3468 WP_003874820.1.35500 WP_003874820.1.35606 WP_003874820.1.37369 WP_003874820.1.37642 WP_003874820.1.40837 WP_003874820.1.45459 WP_003874820.1.45501 WP_003874820.1.47364 WP_003874820.1.53280 WP_003874820.1.59922 WP_003874820.1.646 WP_003874820.1.66027 WP_003874820.1.66905 WP_003874820.1.74562 WP_003874820.1.76287 WP_003874820.1.78145 WP_003874820.1.81101 WP_003874820.1.81559 WP_003874820.1.8174 WP_003874820.1.82097 WP_003874820.1.82175 WP_003874820.1.82859 WP_003874820.1.83216 WP_003874820.1.88396 WP_003874820.1.89157 WP_003874820.1.9350 WP_003874820.1.98852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]