SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-A0SVH2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-A0SVH2
Domain Number 1 Region: 411-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.93e-72
Family Protein kinases, catalytic subunit 0.000000484
Further Details:      
 
Domain Number 2 Region: 272-367
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-35
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 29-118
Classification Level Classification E-value
Superfamily Immunoglobulin 3.4e-21
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-A0SVH2
Domain Number - Region: 140-228
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0017
Family Frizzled cysteine-rich domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-A0SVH2
Sequence length 908
Comment $ NYSGXRC $ SQ252292 $ PDBT193697 $
Sequence
MEIPDSNDPLGHVEGLERPIPTPKGYFLTFLEPVNNITIVQGQTAILHCKVAGNPSPNVR
WLKNDAPVVQEPRRIIIRKTDYGSRLRIQDLDTTDTGYYQCVASNGMKTITATGVLFVRL
GPTNSPNHNLQEDYHGDGFCQPYRGIACARIIGNRTIYVDSLQMQGEIENRITAAFTMIG
TSTHLSDQCSQFAIPSFCHFVFPLCDERSRTPKPRELCRDECEVLENDLCRQEYNIARSN
PLILMQLQLPKCEDLPRPDTLEAANCIRIGIPVERLSRYHQCYNGSGADYRGTVSVTKSG
HICQHWDSQSPHNHDLTSTQFPELGGGHAYCRNPGGQMDGPWCFTKNKNVRMELCDIPSC
SPRDNSKMGILYILVPSIAIPLIIACLFFLVCMCRNKQKASATTPQRRQLMASPSQDMEM
PLINQHKQTKLKEINLSTVRFMEELGEERFGKVYKGHLFGTAPGEQTQAVAIKTLKDKAE
LSLREEFKHEAMMRSRLQHPNIVCLLGIVTKEQPISMIFSYCSHSDLHEFLVMRSPHSDV
GSTDDDKTVKSTLEPADFFHIVTQIAAGMEYLSSHHVVHKDLATRNILVFDKLNVKISDL
GLFREVYAADYYKLMGNSLLPIRWMSPEAIMFGKFSIDSDIWSYGVVLWEVFSYGLQPYC
GYSNQDVIEMIRNRQVLPCPDDCPTWVYTLMLECWNEFPNRRPRFKDIHNRLRTWGNLSN
YNSSAQTSGASNTTQTSSLSTSPVSNVSNARYIGPKQKTPAFPQPQFIQMKGQMRPMVPP
PQLYIPVNGYQPMPAYGAYLPNFYSVQIPMQMAPQQMPPQIIPKPGSHHSGSGSTSTGYV
TTAPSNASVADRAALLSEGTDDTNNGAEDIAQNPVQEEEEEEGSVPETELLGDNDTLQMD
EAEIQSEA
Download sequence
Identical sequences ENSGALP00000024493 NYSGRC-IgSF-A0SVH2 9031.ENSGALP00000024493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]