SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-NP_989840 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-NP_989840
Domain Number 1 Region: 427-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-76
Family Protein kinases, catalytic subunit 0.000000254
Further Details:      
 
Domain Number 2 Region: 270-353
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-33
Family Kringle modules 0.00063
Further Details:      
 
Domain Number 3 Region: 22-114
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-22
Family I set domains 0.024
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-NP_989840
Domain Number - Region: 130-217
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00262
Family Frizzled cysteine-rich domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-NP_989840
Sequence length 896
Comment $ NYSGXRC $ SQ251844 $ PDBT191981 $
Sequence
MPTSSWNISSELDRDYFLTLDEPMNNITTTLGQTAELHCKVSGNPPPTVRWLKNDAPVVQ
EPRRISFRATSYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGS
SDEYEEDGFCQPYRGIACARFIGNRTIYMESLHMQGEIENQITAAFTMIGTSSHLSDKCS
QFAIPSLCHYAFPYCDETSPAPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
NCEDLPQPDSPEAVNCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTRSGRQCQPWNSQ
YPHTHTFTAIRYPELNGGHSYCRNPGNQKDAPWCFTLDENFKSEICDVPACDYKDAKEKN
KMEILYILVPSVTIPLAIALLFFFICICRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYK
PKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLIAIKTLKDFNNPQQWAEF
QQEASLMAELHHPNIVCLLGVVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDED
GTVKSSLDHGDFLHIAVQIAAGMEYLSSHFFVHKDLATRNILIGEQLHVKISDLGLSREI
YSADYYRVQNKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQE
VIEMIRKRQLLPCSEDCPPRMYSLMTECWHDLPSRRPRFKEIHTRLRSWEGLSSHTSSTT
PSGGNATTQTTSLSASPVSNLSNPRYPNYMFPAQGIPQGQIAGFIGPPIPQNQRYIPING
YPIPAGYAAFPAAHYQPQGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEAN
IPLLSHMSIPSHPGGIGITVFGNKTQKPYKIDSKQSSLLGDSSIHGPNESVISAEL
Download sequence
Identical sequences F1NML5
NYSGRC-IgSF-NP_989840 ENSGALP00000017932 NP_989840.2.86415 ENSGALP00000017932 9031.ENSGALP00000017932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]