SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-Q8AXY6 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-Q8AXY6
Domain Number 1 Region: 604-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-82
Family Protein kinases, catalytic subunit 0.000000000166
Further Details:      
 
Domain Number 2 Region: 437-520
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-35
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 3 Region: 94-184
Classification Level Classification E-value
Superfamily Immunoglobulin 7.41e-24
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 4-101
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 179-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000241
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-Q8AXY6
Domain Number - Region: 294-381
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0902
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-Q8AXY6
Sequence length 921
Comment $ NYSGXRC $ SQ251019 $ PDBT185317 $
Sequence
APFISTPLETVDALVEDVAKFVCVVESYPEPEITWTRNSIPIRLFDTRYSIQRNGQLLTI
LSVEDSDDGVYCCTADNGVGAAAQSCGALQVKMRPKITRPPVNVEIIEGLKAVLPCTTMG
NPKPSVSWIKGETVVKENARIAVLDSGNLRIHNVQREDAGQYRCVAKNSLGSAYSKPATV
IVEVFARILKAPESQNITFGSMVTLRCTAAGAPVPTVTWLENGKAVSAGSIAESVKDRVV
DSRLQVYVTRPGLFTCLATNKHSKTFGAAKAAATISVSGVPKLYKGDAGYCSTYRGEVCS
AILSRNALVFFNSSYADPEETQELLVHTAWTELKTVSSFCQPAAESLLCNYIFQECKPSG
VGPAPKPICRENCLAVKDLYCFKEWLSMEENSQRGIYKPGLMLLALPECNRLPSLHQDPS
ACTHIPFFDFKKENITRTCYSGNGQFYQGWANVTASGIPCQKWSDQAPHLHKRTPQVFPE
LSDAENYCRNPGGENERPWCYTKDPSVTWEYCSVSPCGDASLSLGTRKPNGETQNLPPPP
SYSPTYSMNVIILIISSFALIVILGIITLVCCRRRKQWKNKKRESETPTLTTLPSELLLD
RLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMV
AVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEY
LRDRSPRNLCSLVQGGLEARACLLNPLALCCTSQLCIAKQVAAGMAYLSERKFVHRDLAT
RNCLVGENMVVKIADFGLSRNMYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAY
GVVLWEIFSYGMQPYYGMAHEEVIYYVRDGNILSCPDNCPLELYNLMRLCWSKLPADRPS
FASIHRILERMYERAVASPQV
Download sequence
Identical sequences NYSGRC-IgSF-Q8AXY6 ENSGALP00000032134 9031.ENSGALP00000025318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]