SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-Q9Z139 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-Q9Z139
Domain Number 1 Region: 467-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.19e-76
Family Protein kinases, catalytic subunit 0.000000292
Further Details:      
 
Domain Number 2 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-34
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-21
Family I set domains 0.036
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-Q9Z139
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00209
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-Q9Z139
Sequence length 937
Comment $ NYSGXRC $ SQ251119 $ PDBT185533 $
Sequence
MHRPRRRGTRPPPLALLAALLLAARGADAQETELSVSAELVPTSSWNTSSEIDKGSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRN
LDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAF
LFFFICVCRNNQKSSSPPVQRQPKPVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECTFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSSLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRFPNYMFPSQGITPQGQIAGFIGPAIPQNQRFIPINGYPIPPGYAAFPAAHYQPAG
PPRVIQHCPPPKSRSPSSASGSTSTGHVASLPSSGSNQEANVPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQSSLLGDSHIHGHTESMISAEV
Download sequence
Identical sequences Q9Z139
NP_038873.2.92730 ENSMUSP00000048171 10090.ENSMUSP00000048171 ENSMUSP00000048171 ENSMUSP00000048171 NYSGRC-IgSF-Q9Z139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]