SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-ROR1_HUMAN from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-ROR1_HUMAN
Domain Number 1 Region: 467-757
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.17e-76
Family Protein kinases, catalytic subunit 0.0000003
Further Details:      
 
Domain Number 2 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-ROR1_HUMAN
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-ROR1_HUMAN
Sequence length 937
Comment $ NYSGXRC $ SQ251447 $ PDBT189279 $
Sequence
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL
LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL
Download sequence
Identical sequences K7CHI3 Q01973
gi|134152725|ref|NP_005003.2| NYSGRC-IgSF-ROR1_HUMAN NP_005003.2.87134 NP_005003.2.92137 XP_016775314.1.37143 ENSP00000360121 ENSP00000360120 9606.ENSP00000360120 ENSP00000360120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]