SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-ROR2_HUMAN from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-ROR2_HUMAN
Domain Number 1 Region: 443-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.83e-72
Family Protein kinases, catalytic subunit 0.000000453
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 68-156
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  NYSGRC-IgSF-ROR2_HUMAN
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0262
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-ROR2_HUMAN
Sequence length 943
Comment $ NYSGXRC $ SQ251876 $ PDBT192077 $
Sequence
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA
Download sequence
Identical sequences Q01974
ENSP00000364860 NYSGRC-IgSF-ROR2_HUMAN ENSP00000364867 NP_004551.2.87134 NP_004551.2.92137 ENSP00000364860 gi|19743898|ref|NP_004551.2| 9606.ENSP00000364860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]