SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-LECT-ENSMUSP00000097909 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-LECT-ENSMUSP00000097909
Domain Number 1 Region: 375-506
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 234-367
Classification Level Classification E-value
Superfamily C-type lectin-like 2.44e-37
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 3 Region: 827-952
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-34
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 4 Region: 961-1110
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-34
Family C-type lectin domain 0.00052
Further Details:      
 
Domain Number 5 Region: 517-652
Classification Level Classification E-value
Superfamily C-type lectin-like 4.98e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 662-812
Classification Level Classification E-value
Superfamily C-type lectin-like 1.17e-28
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 7 Region: 1260-1395
Classification Level Classification E-value
Superfamily C-type lectin-like 1.72e-27
Family C-type lectin domain 0.003
Further Details:      
 
Domain Number 8 Region: 1121-1250
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 40-171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.63e-23
Family Cysteine rich domain 0.0021
Further Details:      
 
Domain Number 10 Region: 171-229
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-LECT-ENSMUSP00000097909
Sequence length 1479
Comment $ NYSGXRC $ SQ250911 $ PDBT186073 $
Sequence
MVPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQ
VRVTPVCNASLPAQRWKWVSRNRLFNLGATQCLGTGWPVTNTTVSLGMYECDREALSLRW
QCRTLGDQLSLLLGARASNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLN
DLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
KPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIH
SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVI
YSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEV
IYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEH
FVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDD
IRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFE
HHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFR
WTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQP
QDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQA
FITASLPNVTFDLWIGLHASQRDFQWIEQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVI
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQ
KPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTPLWIGLASEEGSRRYSWLSE
EPLNYVSWQDEEPQHSGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCP
QGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAE
AQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPG
ACTNITMGVVCKLPRVEENSFLPSAALPESPVALVVVLTAVLLLLALMTAALILYRRRQS
AERGSFEGARYSRSSHSGPAEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences Q64449
ENSMUSP00000021038 ENSMUSP00000097909 10090.ENSMUSP00000097909 ENSMUSP00000097909 NP_032652.3.92730 NYSGRC-LECT-ENSMUSP00000097909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]