SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-LECT-ENSP00000307513 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-LECT-ENSP00000307513
Domain Number 1 Region: 376-507
Classification Level Classification E-value
Superfamily C-type lectin-like 6.07e-42
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 518-653
Classification Level Classification E-value
Superfamily C-type lectin-like 6.87e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 827-953
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-33
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 5 Region: 960-1111
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-33
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 6 Region: 661-811
Classification Level Classification E-value
Superfamily C-type lectin-like 7.93e-29
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 7 Region: 1256-1396
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-27
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.53e-26
Family Cysteine rich domain 0.0047
Further Details:      
 
Domain Number 9 Region: 1126-1252
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 10 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-LECT-ENSP00000307513
Sequence length 1479
Comment $ NYSGXRC $ SQ244259 $ PDBT194366 $
Sequence
MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRF
RWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQ
PPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ
AFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAV
VLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLL
QKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS
EEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQS
YEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNITMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences Q9UBG0
ENSP00000307513 ENSP00000307513 9606.ENSP00000307513 gi|110624774|ref|NP_006030.2| NYSGRC-LECT-ENSP00000307513 ENSP00000307513 NP_006030.2.87134 NP_006030.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]