SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-SEC-TGGT1_014190 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-SEC-TGGT1_014190
Domain Number 1 Region: 219-304,333-411
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.44e-41
Family Anthrax protective antigen 0.0033
Further Details:      
 
Domain Number 2 Region: 713-814
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-19
Family LCCL domain 0.002
Further Details:      
 
Domain Number 3 Region: 829-978
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000723
Family YxiM N-terminal domain-like 0.04
Further Details:      
 
Domain Number 4 Region: 563-677
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000731
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.08
Further Details:      
 
Weak hits

Sequence:  NYSGRC-SEC-TGGT1_014190
Domain Number - Region: 40-84
Classification Level Classification E-value
Superfamily Kringle-like 0.0739
Family Fibronectin type II module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-SEC-TGGT1_014190
Sequence length 998
Comment $ NYSGXRC $ SQ247428 $ PDBT191865 $
Sequence
MMLGRLLFAASIIPWQQCLAQDVGYNLGPLQQLTQFRKQHRRTVDGRLCAAAFVQDDQTY
TDCTGARAPDGKAGGEWCYVEVQLLGKGGRDWNWCIPPINYDKVRSKSREAFEMKATEAE
KMIARLDGSISRVDDMLHRHSATCGSRHDSVGRQVEKIEKVLSHSRSCLKKVEEASGKIG
ALEKDIIAIQNDIATSRRRLFAQPENCETVPGYEDEPFPDGIKGYYYGNARFSGAPRAIR
IDRAIDFVFAGAGPVEGLTSQQYSIRWDGYLLAPRSGDFTFSIETDSGVRVFLNQQPIIV
DRMPPATETDAIGDKIVPLTAVAGHPGSHTTESVPLELTAGEKYKLRVELVHTCHFKYEN
SDSASLKLSWQSPGVKKEVISGKYFFTSSPSSPVKVSGLDPQLFQISLLYSGEKAFADSE
QFVVADIPQKYQGMKTIRGPSDPAVDYFEFSANMPVDVYVASSGRATLPLSPSEKQPWTA
HDTGDDLSVYRGTNPLSSALDSSLMKIWQISFPEGGLISFDVTDKGVPFLLFLEGKKANA
QSCGGQQQVLSLVGGPTFAECEASSQLSEEFGCQAALNGRNMDVKNGVWRTAGGNGVGEY
IVVRFNRPVQITHFRFKPRGDAVTWPSEIVLSFSGDGDDEAGDTFGILHTQSMEHNSYKL
KQPAITNYVRATISQMYVNGEDSGGSFEFLGTACSLPEEGLDTEAETPKFAIDNCASTME
DIPELLPLQEGEQFFAVCPRSCALSLEGYVYGTDVYAPESSLCKAALHSGVCSAFSACRM
LVTVTGPRKSFPASSQNGISSYAHGPSDSSLSFSKTSCTESLLSRAPIKYKISFGTGAPE
SGWLLDNGSVKRRQQGVVYGWLRPAEATKCPELGFSNPLNKEGILFPPAASSDECKRGAD
CRTNFWSLSVPDNGRYRVEVQLGNPCSPTAATNYLQVNGTPVAHGVKLEKGRFYVATADV
DVTDKIIVLSSLCDITGNTKELCEDAVTTIMNVIIEKM
Download sequence
Identical sequences S7UZI1
NYSGRC-SEC-TGGT1_014190 gb|TGGT1_014190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]