SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-10166c from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-10166c
Domain Number 1 Region: 19-198
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.38e-33
Family YiiX-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-10166c
Sequence length 202
Comment $ NYSGXRC $ SQ107340 $ PDBT182262 $
Sequence
LLSLLLLALLPTSALALRLHDGDLLFVTAARTGLSGAIDDATATQGAPSFDHVGLVAHDG
RARVVLHADEEGSRQQPLADFIRQARAKQRQIFVYRLNAAQRAAIPDAIAQARRMLGKPY
NLTYVQDDNSYYCSDFIERAFRAHQVFALQPMNFKNPQSGQMSAYWTEFYRSKGMDVPQG
LPGTNPNDMARAPALQALGPLD
Download sequence
Identical sequences NYSGXRC-10166c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]