SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-21013a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-21013a
Domain Number 1 Region: 82-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.14e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-21013a
Sequence length 219
Comment $ NYSGXRC $ SQ216795 $ PDBT175817 $
Sequence
MLTIYGVYRSRATRTLWLAAELGIEFKHVPVIQARRLADPLATDAPLNTLSPAFLAVNPM
GTIPCIEDDGMVLYESMAINLYLARKYGGPLAPVDLKEDAAMLQWSFFAATEIETNSLKI
SSAIAEGLAESDAGKAVIDVAARLLKRPLRVLEQHLATHDYLVGDRFTVADLNVAEIVRY
AQGHQPLFDAHPALKAWLARCQARTAFKSMWDSRTAEAA
Download sequence
Identical sequences A0A083ZQA8 A9CJU4 F5JA79
gi|15888177|ref|NP_353858.1| NP_353858.1.86381 WP_006312247.1.51814 WP_006312247.1.57042 WP_006312247.1.66048 WP_006312247.1.84136 WP_006312247.1.9015 176299.Atu0836 NYSGXRC-21013a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]