SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-6410b from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-6410b
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.43e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.044
Further Details:      
 
Domain Number 2 Region: 164-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000363
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-6410b
Sequence length 350
Comment $ NYSGXRC $ SQ13193 $ PDBT173053 $
Sequence
MESIKVVIVGGGQAGIAMGYYLVKEKVPFMILDANEQVGDSWRNRYDSLVLFTPRTYSQL
PGFPMDGAPNGFPTKDEMASYLQQYANHFNLPMRHHTKVDRVTRQQNGRFHLKTTNGWIE
AEKVVIATGAFQKPYLPPVLDSANNEMSQVHSSAYRNPAQIPGKSVLVVGGGNSGAQIAV
ELAKERNVTMAISHPFRFLPLKLLNKSMFSWLEWGGLLYAGIDTTRGRWFKKQKDPIFGK
ELKSLIKKGQIHLKPRVMNVQGKEVEFADHSRLSFDRIIWSTGFSPSYEWIDIDGVIATN
GWPIHNRGITNIRGLYFLGLPWQYQRGSALVCGVGRDAEYLVPFIKHGDK
Download sequence
Identical sequences Q9K6Q1
355692 BhR165 NYSGXRC-6410b WP_010899803.1.28103 272558.BH3677 gi|15616239|ref|NP_244544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]