SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPTIC1438 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPTIC1438
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.85e-45
Family Type II thymidine kinase 0.00000784
Further Details:      
 
Domain Number 2 Region: 142-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-16
Family Type II thymidine kinase zinc finger 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPTIC1438
Sequence length 194
Comment $ SPINE $ SQ80891 $ PDBT329936 $
Sequence
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIBNRYSEEDVVSHNG
LKVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
Download sequence
Identical sequences OPTIC1438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]