SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PaR356A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PaR356A
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PaR356A
Sequence length 120
Comment $ NESG $ SQ189013 $ PDBT156845 $
Sequence
GANALDFYPEPLREEIERLNGRIYPAVNNGVYRAGFATRQDAYEEAFVQLFEELDYLEGL
LGERRYLAGEYLTEADIRLFTTLVRFDAVYHGHFKCNLRRIEDYPNLSGWLRELYQRPGI
Download sequence
Identical sequences PaR356A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]