SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pfal00047AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfal00047AAA
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.74e-28
Family Thioltransferase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pfal00047AAA
Sequence length 171
Comment $ SGPP $ SQ69415 $ PDBT227507 $
Sequence
MIMKNKYGVFFSLSKNAIINSNRQLFPFKKVSKINFSNSADDKNNGVIPEQRTQYSGTNE
YKDFEKTEVYQTLKIKIKELLEQEKIVLFMKGTPEKPLCGFSANVVNILNSMNVKDYVYI
DVMKNNNLREAIKIYSNWPYIPNLYVNNNFIGGYDIISDLYNRGELEKIIK
Download sequence
Identical sequences A0A024VDX5 A0A024VX33 A0A024WEJ9 A0A024WX11 A0A024XEN1 A0A0L0CX33 A0A0L1IFV0 A0A0L7K898 A0A0L7M7Y2 O97232 Q7K5X2 W4INZ0 W4IQN0 W7F804 W7FW06 W7K4E3 W7KCM9
PFDG_03847T0 5833.PFC0205c-1 PFC0205c PFHG_01048T0 Pfal00047AAA XP_001351121.1.26446 gi|124504757|ref|XP_001351121.1| gi|4493888|emb|CAB38997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]