SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pfal004501AF1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfal004501AF1
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily Histone-fold 3.02e-33
Family Nucleosome core histones 0.0000155
Further Details:      
 
Domain Number 2 Region: 224-257
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000131
Family Chaperone J-domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pfal004501AF1
Sequence length 351
Comment $ SGPP $ SQ69835 $ PDBT227927 $
Sequence
GPGSMARTKQTAKKSTAGKAPRKQLASKAARKSAPISAGIKKPTDIDQELLVREIAQDYK
TDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERSSENS
GKSENSGKSEISGKSEISGNSENARNSENFGNSEISENSESAERSRIPEDCPTPENTPNS
ENSVNVANSEFAENHVVVVEQLNDQERNQEEGSTNCSNVVEEEMTLEKCKEMFLQIQKAY
EILKNPVLRENYDFYGLDKDLDEFQTYYEPRLFHSRINVKDIHKYESFYKGSAEEKEDLM
YFYEKFHGDLNNILEFIPFSESTDLNRFIGIFEKSFDDGEIVKTELYEKSL
Download sequence
Identical sequences Pfal004501AF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]