SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pfu-1211434-001 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfu-1211434-001
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily Histone-fold 0.00000229
Family TBP-associated factors, TAFs 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pfu-1211434-001
Sequence length 59
Comment $ SECSG $ SQ52109 $ PDBT15887 $
Sequence
MVELLVKSKVKEFVSSIDKDMRVSPEFYEALEAEVKALIEKAVKRAQAEGRKTLYARHV
Download sequence
Identical sequences I6V1Y9 Q8U1D0
WP_014835376.1.13913 WP_014835376.1.59273 gi|397651779|ref|YP_006492360.1| Pfu-1211434-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]