SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pfu-640386-001 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfu-640386-001
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Histone-fold 2.15e-52
Family Bacterial histone-fold protein 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pfu-640386-001
Sequence length 153
Comment $ SECSG $ SQ46331 $ PDBT14359 $
Sequence
MAEMVIPYPHLQRILEKTCELAVTKPMAERMMEIVERKLADLFEVAYENATAENSETIKM
RHIPITKGFRSSMNLFRAVIEDENIKIEPILDYVLRKIPADKPLEEEVINELPIITGTLF
VLIGRVIKALHPEVRNVYPEHIEEAEKVLDYTL
Download sequence
Identical sequences I6UNQ3 Q8U348
Pfu-640386-001 gi|397651127|ref|YP_006491708.1| WP_011011744.1.13913 WP_011011744.1.59273 gi|18976996|ref|NP_578353.1| 186497.PF0624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]