SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pkno000415DAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pkno000415DAA
Domain Number 1 Region: 18-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-39
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pkno000415DAA
Sequence length 185
Comment $ SGPP $ SQ81512 $ PDBT215366 $
Sequence
MAHHHHHHMIEKHLLDALRDKENEIDLEIKRYEKLERKIYDDNDEELEFIKNKRLQELKN
KHNENLNLLKKGHGIYKEVLSEKEFFEICKSSKNVCCHFYRNTTWRCEYLDSKLISMSKK
FLHINFIKINAEKSPFLCERLKIWCIPTLMLIQNGKTEHSIIGFDELGGDNFSEQTLINV
LKKWK
Download sequence
Identical sequences Pkno000415DAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]