SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R08C7.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R08C7.3
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily Histone-fold 1.04e-41
Family Nucleosome core histones 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R08C7.3
Sequence length 140
Comment $ SECSG $ SQ48439 $ PDBT1594 $
Sequence
MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAI
LEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYL
MNKKGAPVPGKPGAPGQGPQ
Download sequence
Identical sequences A0A1I7TDU4 Q27511
R08C7.3 R08C7.3 NP_500569.1.50509 R08C7.3.1 R08C7.3.1 R08C7.3.2 R08C7.3.3 6239.R08C7.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]