SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RR161 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  RR161
Domain Number - Region: 41-125,155-179
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.082
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RR161
Sequence length 233
Comment $ NESG $ SQ99502 $ PDBT135180 $
Sequence
MTTVSVQIPAGWPATEERARAVQDELRARVVLDEPGPPPGTGRVTGVDVAYDDERDVVAA
AAVVLDAGTLAVVAEATAVGRISFPYVPGLLAFREIPTVLAALEALPCPPGLVVCDGYGL
AHPRRFGLASHLGVLTGLPTIGVAKNPFTFTHDDPDTPRGSTSPLLAGAEEVGRAVRTRD
GVKPVFVSVGHRVGLGNACAHTLALTPAYRLPETTRRADALCRAALRDAAYRA
Download sequence
Identical sequences A0A1H2DAL7 Q9X7N2
gi|21225020|ref|NP_630799.1| RR161 RR215 NP_630799.1.49638 WP_011031135.1.58943 100226.SCO6726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]