SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RnR20 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RnR20
Domain Number 1 Region: 129-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.37e-20
Family Ubiquitin-related 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RnR20
Sequence length 227
Comment $ NESG $ SQ148944 $ PDBT146386 $
Sequence
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPTPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHS
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Download sequence
Identical sequences G3GZX3 Q68FV8
NP_001013171.1.100692 NP_001013171.1.4139 XP_003497803.1.69978 RnR20 ENSRNOP00000018485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]