SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SnR121A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SnR121A
Domain Number 1 Region: 28-148
Classification Level Classification E-value
Superfamily ARM repeat 3.46e-17
Family PBS lyase HEAT-like repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SnR121A
Sequence length 189
Comment $ NESG $ SQ187590 $ PDBT156714 $
Sequence
GLVRAVAALSAARTDAAIPTLISVLAFNNPGAAVVAVDGLIQLGSPAAQAILNNLDDYNY
GARAWALRALAGIGEPAALPLLLSAAREDFSLSVRRAATYGLGRVRWADLSESDRLAQQQ
QCYETLKLCLQYDPEWVVRYAAAAALETLAPAATQLQSAIAETLNRQAHSDEERAVQARS
RLAERRLAG
Download sequence
Identical sequences SnR121A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]