SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbru003828AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbru003828AAA
Domain Number 1 Region: 94-137
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000009
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbru003828AAA
Sequence length 141
Comment $ SGPP $ SQ60294 $ PDBT218062 $
Sequence
MAHHHHHHMIIPESVRGVNSEALPNPWSQSTNTADSGNTNTFSNAAMNLFGIPGNVGHPS
LGNLFGSGLGGPFPFMSPGISIPQTGVTASQRGDDATRWSQQLAMLKDMGFMDEELCLDA
LRMTNGDVDMAVNFIVNKDSS
Download sequence
Identical sequences Tbru003828AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]