SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbru019066AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbru019066AAA
Domain Number 1 Region: 25-131
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-20
Family Single strand DNA-binding domain, SSB 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbru019066AAA
Sequence length 131
Comment $ SGPP $ SQ58206 $ PDBT215611 $
Sequence
GPGSMRSAVNLGGAPRVPSQRLPAFEGVSPRIVARQVPAHRGEYVSLVLRPTSLNAQRNS
LVASCVVTDESVEVMGLPADAEVAQVNEFVCYINPSSGELEYYQHGTYNDEYDVDVYRKL
LELCPKFPALF
Download sequence
Identical sequences Tbru019066AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]