SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tcru005179AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tcru005179AAA
Domain Number - Region: 111-141
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0471
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.013
Further Details:      
 
Domain Number - Region: 37-119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0633
Family Galectin (animal S-lectin) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tcru005179AAA
Sequence length 171
Comment $ SGPP $ SQ72313 $ PDBT230300 $
Sequence
MAHHHHHHMGLLHLTRLSEFMRRRRHSSLKIPLQLHVRCGPRDKKLRNNNAVCVNTATNQ
WEKTNHPVRVHNTQFLHVSCRHHSNGLLVNGSAFLLLKLNFPFVMQETMEYEGNFVHTYL
LPCHSTCCVYALSDGAIPSICGPLVGGKNVTVLNHCSKNKVRRRRHRHKCL
Download sequence
Identical sequences Tcru005179AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]