SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tcru024861AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tcru024861AAA
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.02e-25
Family Helical domain of Sec23/24 0.0026
Further Details:      
 
Domain Number 2 Region: 127-275
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.18e-24
Family C-terminal, gelsolin-like domain of Sec23/24 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tcru024861AAA
Sequence length 279
Comment $ SGPP $ SQ57617 $ PDBT214951 $
Sequence
MAHHHHHHMSVVTTLSGVFEADLEATLMGYIHEAIGNAVNKGLQYARSTAQDRVLKMLIA
YRRVCTSNATSSLLMPSRLRLIPLFVLSFMKADALVEGTTVPIDDRVQKLFLLMTIPMHQ
CVTYLYPTLYAVHHLLSEPTSGVIDPETGHCVLPGWQQLIFDSITTDGVYVLCDEQARIV
YLWIGSSVVPEVSLELFGTTNALDVGRTVFFENFGERLKNVLYTCLMRDDGMRRFVILHE
KDRGEEAFFRQFKEENEGGSMGYDQLLVHLHREVKKSIE
Download sequence
Identical sequences Tcru024861AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]