SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W00151 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W00151
Domain Number 1 Region: 8-107,280-337
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.49e-47
Family Matrix metalloproteases, catalytic domain 0.000000368
Further Details:      
 
Domain Number 2 Region: 168-225
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-22
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 3 Region: 228-284
Classification Level Classification E-value
Superfamily Kringle-like 1.63e-21
Family Fibronectin type II module 0.0000774
Further Details:      
 
Domain Number 4 Region: 112-167
Classification Level Classification E-value
Superfamily Kringle-like 2.54e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W00151
Sequence length 358
Comment $ ISPC $ SQ76805 $ PDBT240997 $
Sequence
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADI
MINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNAD
GEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQ
PCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPC
VFPFTFLGNKYESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAM
GLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVT
Download sequence
Identical sequences W00151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]