SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WR190 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WR190
Domain Number 1 Region: 44-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-60
Family NQO2-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WR190
Sequence length 239
Comment $ NESG $ SQ28865 $ PDBT116263 $
Sequence
MSLASNVLLQASRLGEMVIKRGGATGLMVHRDTKENNLNVKFKFTSENQERIKAIMDIYP
EGHKAGALIPLLDLAQRQHGWLPISAMHEVAKILEVPRMRAYEVATFYTMFNRQPVGKYF
LQVCATTPCMLRGAETITETIEKKLGIHAGETTKDGLFTLAEVECLGACVNAPMIQINDD
YFEDLTPKDVNEILDDLKAGRKPAAGPRSGRLAAEPFGELTSLKETPPGPGFGLQAALK
Download sequence
Identical sequences Q20719
F53F4.10 F53F4.10.1 F53F4.10 WR190 NP_506376.1.50509 F53F4.10 6239.F53F4.10.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]