SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WR334 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WR334
Domain Number - Region: 30-80
Classification Level Classification E-value
Superfamily Tropomyosin 0.0595
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WR334
Sequence length 128
Comment $ NESG $ SQ28990 $ PDBT116407 $
Sequence
METVDYEYSVEEDHEDDEYKSTKNETIKKFLIDRKQLEKALRLAAENEKKLKSMLDESGK
WFDRYEKMIDDLDEQLTTYNTNRKIVLDNIINGVSYWGGGAVVPRFWSENRYLIRCGRAT
ASVQKIYA
Download sequence
Identical sequences WR334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]