SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XcR100 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XcR100
Domain Number - Region: 19-95
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0314
Family Cellulose-binding domain family III 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XcR100
Sequence length 245
Comment $ NESG $ SQ93581 $ PDBT133660 $
Sequence
MRTTLKPLLLALSIAAGTAMTAHAQTAPSYTIPNDGTLLNVSAEAEAKRVPDIATVSAGV
VTQAVDGNAAMRQNAEQMSKVMTAVKAAGIADKDVQTSGINLNPQYSYKENEAPKIIGYQ
ASNTVSLKVRDIAKLGKVLDALVAQGANDINGPSFSIDQPEPVYDEARVAALKKARARAE
TYAKSLGLKVRRIVSISEGRNGGGVVPPMMMAASMRSAKAEMDTQVAPGESTLSITLDVT
FELGR
Download sequence
Identical sequences A0A0H2X615 Q8P7K0
gi|21232042|ref|NP_637959.1| gi|66767831|ref|YP_242593.1| 190485.XCC2611 314565.XC_1505 XcR100 NP_637959.1.47755 WP_011037741.1.12496 WP_011037741.1.16446 WP_011037741.1.1732 WP_011037741.1.18295 WP_011037741.1.27778 WP_011037741.1.31612 WP_011037741.1.40219 WP_011037741.1.475 WP_011037741.1.56666 WP_011037741.1.88278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]