SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZC155.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZC155.2
Domain Number 1 Region: 108-206
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000189
Family Nucleosome core histones 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ZC155.2
Sequence length 213
Comment $ SECSG $ SQ53614 $ PDBT4089 $
Sequence
MRRVSINSFLEPNSPNVPNRVTIPDGDLRRNSDDTATDRISLTNQLGKSAYSTTTEDSID
SETSETRMDSSRTSEISGNVKEDPVSENQYVLENSESSESIVVDLEMPGMTLRSKASPRK
RYMSKKEKDLNDEKKNFKDLVLTIGQNQIQDPDEDFQITKEAIDLLQSESDKILLEMFTS
SNAIATAGERDILTPTDIQTARHIQMIMKKYKK
Download sequence
Identical sequences Q23245
ZC155.2 ZC155.2 6239.ZC155.2 NP_498108.1.50509 ZC155.2 ZC155.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]