SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK131.5 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK131.5
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily Histone-fold 6.93e-56
Family Nucleosome core histones 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ZK131.5
Sequence length 122
Comment $ SECSG $ SQ8667 $ PDBT15563 $
Sequence
MPPKPSAKGAKKAAKTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
Download sequence
Identical sequences G0PJM6 P04255
CBN03439 CBN03502 CBN05890 CBN07325 CBN07662 CBN09238 CBN17507 CBN21819 CBN23334 CBN24531 CBN25930 CBN26123 CBN32049 CBN32588 F08G2.1 F17E9.9 F35H10.11 ZK131.5 ZK131.9 135651.CBN03439 135651.CBN03502 135651.CBN05890 135651.CBN07325 135651.CBN07662 135651.CBN09238 135651.CBN17507 135651.CBN21819 135651.CBN23334 135651.CBN24531 135651.CBN25930 135651.CBN26123 6239.F08G2.1 6239.F17E9.9 6239.F35H10.11 6239.ZK131.5 6239.ZK131.9 F08G2.1 F17E9.9 F35H10.11 ZK131.5 ZK131.9 1172 F17E9.9 ZK131.5 ZK131.9 NP_496888.1.50509 NP_496892.1.50509 NP_496897.1.50509 NP_501403.1.50509 NP_501409.1.50509 F08G2.1 F17E9.9 F35H10.11 ZK131.5 ZK131.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]