SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for hsi002022477.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsi002022477.1
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-32
Family Ras-binding domain, RBD 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hsi002022477.1
Sequence length 82
Comment $ RSGI $ SQ84122 $ PDBT233405 $
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
ISLNKWGQYASDVQLILRRTGP
Download sequence
Identical sequences hsi002022477.1 d2cs4a1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]