SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for hso002001722.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso002001722.1
Domain Number 1 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 2 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-21
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 3 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000017
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 4 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000641
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 5 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000236
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 6 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000353
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 7 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000523
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 8 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000128
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 9 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000051
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 10 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000072
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 11 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000249
Family Fibronectin type I module 0.0003
Further Details:      
 
Weak hits

Sequence:  hso002001722.1
Domain Number - Region: 618-650
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00353
Family Fibronectin type III 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hso002001722.1
Sequence length 651
Comment $ RSGI $ SQ133770 $ PDBT234276 $
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSC
Download sequence
Identical sequences hso002001722.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]