SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for hss001000780.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hss001000780.1
Domain Number 1 Region: 64-161
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.2e-17
Family SCOPe 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hss001000780.1
Sequence length 175
Comment $ RSGI $ SQ4991 $ PDBT234685 $
Sequence
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Download sequence
Identical sequences A0A2J8X208 P02511 Q5R9K0 V9HW27
2klr_A 2klr_B 2ygd_A 2ygd_B 2ygd_C 2ygd_D 2ygd_E 2ygd_F 2ygd_G 2ygd_H 2ygd_I 2ygd_J 2ygd_K 2ygd_L 2ygd_M 2ygd_N 2ygd_O 2ygd_P 2ygd_Q 2ygd_R 2ygd_S 2ygd_T 2ygd_U 2ygd_V 2ygd_W 2ygd_X 3j07_A 3j07_B 3j07_C 3j07_D 3j07_E 3j07_F 3j07_G 3j07_H 3j07_I 3j07_J 3j07_K 3j07_L 3j07_M 3j07_N 3j07_O 3j07_P 3j07_Q 3j07_R 3j07_S 3j07_T 3j07_U 3j07_V 3j07_W 3j07_X ENSPPYP00000004431 ENSP00000227251 ENSP00000459140 ENSPPYP00000004431 ENSP00000227251 ENSP00000433560 ENSP00000434247 ENSP00000436051 ENSP00000437149 ENSP00000459140 ENSP00000459809 ENSP00000459924 ENSP00000460615 ENSP00000461777 gi|4503057|ref|NP_001876.1| 9600.ENSPPYP00000004431 9606.ENSP00000227251 400610 GO.33774 HR2895 hss001000780.1 NP_001125917.1.23681 NP_001276736.1.87134 NP_001276736.1.92137 NP_001276737.1.87134 NP_001276737.1.92137 NP_001876.1.87134 NP_001876.1.92137 XP_009245315.1.23681 XP_009245316.1.23681 XP_009245317.1.23681 XP_009245318.1.23681 XP_009245319.1.23681 XP_009245320.1.23681 XP_011540910.1.92137 ENSP00000227251 ENSP00000433560 ENSP00000434247 ENSP00000436051 ENSP00000437149 ENSP00000483554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]