SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ttk003000456.4 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ttk003000456.4
Domain Number 1 Region: 4-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.09e-75
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000131
Further Details:      
 
Domain Number 2 Region: 188-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ttk003000456.4
Sequence length 324
Comment $ RSGI $ SQ79752 $ PDBT236880 $
Sequence
MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSE
AAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSG
GGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSV
KEEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLM
PWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYP
YAQDKLYLPTVTRILNAAKRALDY
Download sequence
Identical sequences Q5SLR3
YP_143496.1.19876 300852.TTHA0230 gi|55980199|ref|YP_143496.1| ttk003000456.1 ttk003000456.2 ttk003000456.3 ttk003000456.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]