SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ttk003000730.4 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ttk003000730.4
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.96e-32
Family N-terminal domain of MutM-like DNA repair proteins 0.000000519
Further Details:      
 
Domain Number 2 Region: 121-211
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.12e-31
Family Middle domain of MutM-like DNA repair proteins 0.0000137
Further Details:      
 
Domain Number 3 Region: 214-264
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.04e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ttk003000730.4
Sequence length 267
Comment $ RSGI $ SQ81791 $ PDBT237010 $
Sequence
MPELPEVETTRRRLRPLVLGQTLRQVVHRDPARYRNTALAEGRRILEVDRRGKFLLFALE
GGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHDPRRFGRLFGVRRGDYREIPLLL
RLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPA
RSLTEEEARRLYRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQTRHAVYGREGLPCP
ACGRPVERRVVAGRGTHFCPTCQGEGP
Download sequence
Identical sequences O50606 Q72HN2
ttk003000730.1 ttk003000730.2 ttk003000730.3 ttk003000730.4 gi|46199756|ref|YP_005423.1| gi|55981775|ref|YP_145072.1| WP_011173830.1.52262 WP_011173830.1.85415 YP_145072.1.19876 262724.TTC1454 300852.TTHA1806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]