SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ttk003000988.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ttk003000988.1
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.63e-32
Family HSP20 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ttk003000988.1
Sequence length 137
Comment $ RSGI $ SQ88888 $ PDBT237242 $
Sequence
MMRFDPFKELEELQERLVRAFGAPQQGPRVYAPPVDVWEDEEGLHLLVYLPGVEPEKVEV
VAEEGVLSVKAERPFERKENAAYHRLEGTYGTFVRSFNVPSTYDLSKVQARFRHGVLHLL
VPRAEATKPKKIQVQVE
Download sequence
Identical sequences Q5SI90 Q72IL2
ttk003000988.1 gi|46199422|ref|YP_005089.1| WP_011173534.1.52262 WP_011173534.1.85415 YP_144750.1.19876 262724.TTC1120 300852.TTHA1484 gi|55981453|ref|YP_144750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]